Sequence (93 AA)
MPEEEKLKEALATIEKKKKEFEDRYNNQKRAIGILEEHLEELKKTGKGSGSGDPEQAKKIEAVIKEQKKKLEAEKEAFYKESKALLFEKKKLA
This protein was designed using KRFoldCraft
FoldCraft is a fold-conditioned protein design protocol based on AF2-Multimer hallucination with contact map similarity loss, which drives designs towards both specified structural topology and AF2 binding and structural confidence metrics. We used FoldCraft with cmap loss (3 stage design 100,100,20), then optimized designs using ProteinMPNN, predicted all complexes with AF2-Multimer, relaxed with pyrosetta. All designs passing BindCraft filter were predicted with Boltz2 and ranked with ipSAE metric