Nanobody
Nipah Virus Glycoprotein G
No
xbf|boltzgen|NanoBody-Scaffold|redesign_8XPY
Sequence (119 AA)
EVNLVETGGGVVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGRGLEWVSYISSTSSYTNYADSVKGRFTISRDNTKNTLYLQMQSLKADDTASYYCARGLAGVWGIDVWGNGTLVTVST
This protein was designed using XBStructure Guided Mutagenesis
We inspected the n425–NiV-G complex in the PDB (8XPY), identified loop residues away from the interaction surface, and introduced 11 conservative mutations: preferentially Ser→Thr, Gln→Asn, and Arg→Lys, to generate a minimally perturbed benchmark variant that meets the competition’s >10-mutation criterion. This control design was intentionally not very novel, as we were genuinely curious to see whether this minimally altered sequence would still achieve a high score as an internal benchmark