Sequence (87 AA)
SASVTIAPGETATITVSGPGIYRVTASNKHGSASTEVDTRRPELVTENLTLPDGQGVTVTGGGTSNELHVKALGSSSDPVTVTVTQL
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
The BoltzGen binder designs were generated through Tamarind.bio due to low accessibility to GPUs at my institute, using the binding site residues 314,316,317,318,320,341,342,343,367,369,392,393,394,395 with a length range of 70-100 amino acids and 150 total designs across 1 batch. As the flexibility of the BoltzGen platform is quite rigid in fine-tuning parameters, the core rationale about the design comes mostly from literature review of residues involved in Nipah binding with partners. The 5 top-ranked binder were selected based on optimized metrics including design_to_target_iptm, min_design_to_target_pae, design_ptm, representing the best-performing design out of 71 generated candidates (+ visual inspection of predicted complexes).