Nanobody
Ariax-BG-VHH-6
Sequence (130 AA)
EVQLVESGGGLVQPGGSLRLSCAASGPSDTFTNSVMGWFRQAPGKGRELVAAISPFGNTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCARGDNFGDPTAPFSRNTSAYDYWGQGTQVTVSS
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
VHH were generated using BoltzGen on the Ariax Bio platform. PDB 2VSM was loaded into prep inputs and hotspot binding residues were selected using the proximity detection feature for all residues in chain A (NiVG) within 4.5 angstroms of chain B (ephrinB2). Default settings and filters were used and the top ranked designs from a campaign of 10,000 were selected.