Peptide
EGFR
Yes
tadaskluonis.cotimed_egf_BCseq_0
Sequence (47 AA)
KCPAIYKGYCLNWAKCYYIITLVWVGCQCLKGFCGPRCAFHNLLWPW
Loading protein structure...
This protein was designed using co-TIMED