Nanobody
8XPY-epitope-3.5_3651|rank=1|iptm=0.48793|min_pae=8.93985|ptm=0.80075|rmsd=2.33045|liability_score=190|liability_violations=21
Sequence (119 AA)
EVQLVESGGGLVQPGGSLRLSCAASGLSSSLNYMAWYRQAPGKGRELVAGIWSDGSTSYADSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCAVVPGGIGNLKAYWGQGTLVTVSS
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using EEBoltzgen + NovaDesign
My submission is based on results from BoltzGen targeting an epitope patch identified using a known epitope from 8XPY and adding predicted epitope hot spots using a combination of antigenicity prediction tools that include traditional structure-based tools like ElliPro and some personally developed methods. I filtered unstable poses as predicted by NovaDesign with AMBER14 and gave preference to sequences with higher ipSAE Boltz-2 predictions.