Sequence (113 AA)
EVQLVESGGGLVQPGGSLRLSCAASGPVGYMAWYRQAPGKGRELVAGIEYYTSYADSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCGAGAGYYYTPGAWGQGTLVTVSS
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
Our pipeline uses traditional epitope prediction methods to guide BoltzGen design. Decoys were modeled with Boltz2 using 5 simulations, filtered for ipSAE across all models, and evaluated with NovaDesign's force field-based stability prediction. Poses were inspected visually and programmatically in Protean 3D.