Miniprotein
nipah_design3_r05_s1_model_0
Sequence (54 AA)
GVKAMALPVFNALAKFFGLPPLKATPDDTLASIVAKLIAAVNEKLKTLAKPIFE
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
Boltzgen with num_design 100, budget 10, redesigned top 10 ranked sequences from Boltzgen with ProteinMPNN with 3 new sequences for each boltzgen structure. Refolded in complex with nipah Glycoprotein target sequence using Boltz2 for ipSAE calculation. Performed Foldseek search against AFDB to identify potentially related sequences. Used Prodigy for additional binding affinity estimation. Entire pipeline was executed end-to-end using Nextflow.