Peptide
EGFR
Yes
joaosartori2.c4
Sequence (58 AA)
SHFTRCPSTHRGFCFHGTCRFLVNEEKPPCVCHSGYRGARCEHADLHVIVALLSGLAI
Loading protein structure...
This protein was designed using ESM2 Optimization