Other
RBX1_l99_s902812_mpnn3
SYYEPLPEERELKRAHWRLMKALSEASPNWSDEIWDEIMGATTTAMHLVREGNPNWPEVFVRGVYEIVKEKLPEAVEVFEEIAKEMFPEAYEKVLKELE
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using EBindCraft
BindCraft (Pacesa et al., 2025) with default 4stage_multimer settings. Target: RBX1 RING domain (res 40-108) from PDB 4F52 chain B. Hotspots: A43-44,A46,A55,A86-87,A91,A95-96,A98 (E2/GLMN-binding surface). Binder lengths: 60-140 AA. Sequence redesign: SolubleMPNN. Filtering: default BindCraft filters (pLDDT, i_pTM, i_pAE, Rosetta dG, shape complementarity, clash count, binder RMSD). Executed on NVIDIA A100 80GB GPUs.