Other
IFNAR2
Yes
IFNAR2_b14
Sequence (93 AA)
MSLEDRIEVSIKELEGMDRYYVIVQDKSEYWVAVIVVPKSKFENEEEALKVATHWLMNSLRMQGVSEEKREEILKVAEKKFKEKLKEYKKEIE
Loading protein structure...
This protein was designed using BindCraft