Nanobody
162
Sequence (129 AA)
QVQLQESGGGLVQAGGSLRLSCAASGPIADDEEMGWYRQAPGKEREFVARIYSGGTTEYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCALIGVSDSLGYDGVPSYSFRYWGQGTQVTVSSLE
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using OBindCraft, modified for partial binder design, with ipSAE loss
The above method was applied to a cropped version of the Nipah Virus Glycoprotein G, and a known nanobody scaffold, where the three CDR loops were allowed full flexibility in terms of sequence and structure.