Peptide
EGFR
Yes
biolucasmachado.engineered_binder_6
Sequence (58 AA)
SYFTPCGPEFNGYCVHGECRYVALLNQVACICHDGWTGERCELPDLLAIVASSRNSVD
Loading protein structure...
This protein was designed using ESM2 Optimization