Sequence (83 AA)
KTLTITGPYGEKVYIGGVEGCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNSWGLEFQKNKDIKLLTEKNGKRTLTTIHVKD
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using ARFDiffusion/proteinMPNN/AlphaFold2/Boltz2
A new scaffold was created for residues of EFNB2 interacting with the target protein. One point mutation in a conserved loop was introduced as it was predicted to have a beneficial effect on binding.