Miniprotein
IFNAR2
Yes
IFNAR2_b5
Sequence (80 AA)
SAEVEKINEEFRKRLEEIKKLPLEEQIRALREEIARLQELIQQNMQTGSMMVRAQAHVWIIVLQEEIRRRELELAGLDPS
Loading protein structure...
This protein was designed using BindCraft