Unknown
run-75_ROC1_denovobinder_396
Sequence (115 AA)
QVQLVESGGGLVQAGGSLRLSCAASGFTFSSYYMSWYRQAPGKERELVASISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAAYSSSGIYWGQGTQVTVS
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
For binder design boltzgen 0.1.8 was used. The targed structure was 1ldj, with binding allowed from aminoacid 22 to 88. The binder length was 80..140, with the default boltzgen filtering used at first with the final selection also guided by AF3 confidence metrics.