Other
DERF7
Yes
DerF7_b24
Sequence (98 AA)
MTPEEIMRELFEKYVTARAVIYGADPADAAAALAAQRAALEETIRYFFRYRDVLLNSPEASEDVKTLAENMRQVLEEKAKELGIDLAAIEAEVKAEQA
Loading protein structure...
This protein was designed using BindCraft