Other
design_91_0_partial_cycle_12
MSSRTYKTDKYTINLTVTDGAPPGAAADAAAAYIDAVLAELRARGASDAQLARARRQLEASTKTLHLDVDAPEGVDDDELFADVEKIIDELLAERRTGEAAALHAALVAAKTYLETGDKAEATAAAYASNSKFPSWKLLYLDFDIDAEPA
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using KRFoldCraft
We employed 3stage design protocol (100,100,20) from ColabDesign with our FoldCraft loss for AF2-Multimer hallucination. Only FoldCraft loss was used for design without other AF2 loss functions. ProteinMPNN model with temperature 0.1 generated 2 sequences per designs. The design algorithm was set in loop until we got at least 100 binder passing BindCraft filters.