Unknown
33
Sequence (54 AA)
SEELEELDEEFDEVMETMWKAGGEIKRNGDPEAEKVLEEAIPKLNEILRRRREL
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using EBindCraft
In total, this workflow generated 406 candidates. Initial filtering retained 158 designs that simultaneously satisfied Average_i_pTM > 0.7, Average_ShapeComplementarity > 0.6, and Average_dSASA > 1000. From this set, we further selected designs with Average_Binder_Energy_Score < -120, yielding a final set of 101 candidates. This branch provided an orthogonal source of candidates and expanded the structural diversity of the overall RBX1 binder pool.