Unknown
EGFR
Yes
1.3.3.18_1598_1
Sequence (49 AA)
NSVETCPSTYCLHGGICMFIEAVDRYACKCVVGYVGERCQYRDLRWWSL
This protein was designed using ProtRL