Peptide
EGFR
Yes
1.3.3.18_1395_1
Sequence (52 AA)
SNSVESCPSTHDSYCLNGGSCVFFEIVRQFACKCLSGYMGERCQFSDLEWWD
Loading protein structure...
This protein was designed using ProtRL