Unknown
task-48268998-1313_rbx1_19
Sequence (59 AA)
SAPSRRVDLTGKTAEEGAEAIEAAIKALDGKTLTPEARAAAREFAKRLQGTTVRVEKSD
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using ABoltzGen + AFmm refolding with ipTM and contact analysis
AFmm settings: Run with ColabFold 1.5.5 with the following settings: AFmm v2.3 weights, 1 seed, 5 models, 5 recycles, local mmseqs2 server, unpaired_paired mode
BoltzGen yaml: entities:
BoltzGen rescore settings: use_affinity=False, filter_bindingsite=False, filter_designfolding=False, refolding_rmsd_threshold=2.5, alpha=0, "design_ptm": 2, "neg_min_design_to_target_pae": 1, "design_to_target_iptm": 1, "plip_hbonds_refolded": 4, "plip_saltbridge_refolded": 4, "delta_sasa_refolded": 4, "neg_design_hydrophobicity": 7