Miniprotein
IL-7Ra
Yes
IL7Ra_binder_design_10
Sequence (84 AA)
SVQLEALEILIKELKKELEKAKKELEKASPEEKKKLEEKAKKLEELLKEAEELKKKIEKGEISSEEAAKKIKKISDEYLELKTD
Loading protein structure...
This protein was designed using RFdiffusion