Nanobody
0488|rank=2|iptm=0.21587|min_pae=19.54569|ptm=0.85659|rmsd=2.36691|liability_score=175|liability_violations=20
Sequence (120 AA)
EVQLVESGGGLVQPGGSLRLSCAASGGTIYSMGWFRQAPGKGRELVASITDASRGGTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAASTNPFDDTYFEYWGQGTQVTVSS
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using DProtean 3D epitope prediction, BoltzGen + NovaDesign with ipSAE filtering and MD
ElliPro and Protean 3D epitope prediction (protrusion index, antigenicity prediction by sequence and structural features) BoltzGen using public and private nanobody templates, 30k designs and 200 budget on a 4090 Boltz2 predictions run with ipSAE calculation on the DNASTAR cloud NovaDesign with AMBER-14 stability prediction and light MD