Peptide
EGFR
Yes
paulafcfranklin.synth_rosetta_1
Sequence (53 AA)
SHFSECPDTHRHFCFHGTCRFLLLENKPACICHPGYVGARCEEADLLAVVAAS
Loading protein structure...
This protein was designed using ESM2 Optimization