Unknown
gemM_l156_s19310_mpnn0
Sequence (156 AA)
MKMTPEEAYKKLIELLENLRREILKLGEEAIKNKEDLEEFYKRVKELIEKAIEEIREIGSKSDKETQELANKIVERLRKAAEEIDPSKIPEEIRGELGIRGMIDKLLRVLFELLLELKKAYAEHFNIDLTVNILTLEELPEKELELKLEENEEELE
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using OBindCraft, modified for partial binder design, with ipSAE loss
The above method was applied to a cropped version of the Nipah Virus Glycoprotein G, and a known nanobody scaffold, where the three CDR loops were allowed full flexibility in terms of sequence and structure.