Unknown
rank77
Sequence (120 AA)
MKITYEVRPALTPEEAVALLRSAAPDEIVIILQYDKKTGELTLYYPGTGPGGALGAAVTARLKEKLEKEGSVTLEEVIETIEKVAKELEAQGILKGKTVKIIIAAEDEETRKEIEELLKE
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
Binders were generated using BoltzGen. The number of generations was set to 30,000 with a budget of 150 and an alpha parameter of 0.1 to obtain a more diverse range of structures. The peptide-anything protocol was used. The tail region with the sequence AGKKRFEVKKWNAVALWAW was used as the target fragment for generation. Proteins with lengths ranging from 100 to 160 were generated (similar to the range of successful designs from Liu et al., Nature 2025).