Unknown
91
Sequence (106 AA)
SMREECLRLCDELERLVEQTTDRLALETVVVLLTQVLARLGVIPPKSLDEILDEALSLSLEERKARARALLRELREALERTTDPAALEYALHVLRVLVEFLRGALE
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using MIBoltzGen
The branch of our workflow used BoltzGen for de novo backbone generation. This route was intended to provide structurally diverse binder backbones without relying on template reuse, motif grafting, or direct optimization of known binders. By sampling compact binder-like scaffolds, this pipeline served as a source of novel candidate topologies for downstream sequence design and structural screening.