Peptide
EGFR
Yes
1_3_3_18_63_1
Sequence (54 AA)
STPLNDCPPSHDAYCLYEGICFYFPEMESFACNCVKGYMGERCQFSDLKWWELQ
Loading protein structure...
This protein was designed using ProtRL