Unknown
pepMLM_rank019
Sequence (30 AA)
DAKQVARWAIYGAIRRKIVKAAVTQHFKGG
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using NRpepMLM + Peptiverse
Generation: 500 sequences, length 30 aa, conditioned on RBX1. Filtering: pseudo-perplexity < 30, standard amino acids only, no poly-repeats (≥4 identical consecutive residues), sequence diversity ≥ 35%. Scoring: PeptiVerse API — binding affinity vs RBX1 (pKd), solubility, hemolysis, half-life at pH 7.4. Selection: top 71 by composite score (binding 45%, solubility 25%, hemolysis safety 20%, half-life 10%). All selected sequences: pKd ≥ 7.0, soluble, non-hemolytic.