Unknown
EGFR
Yes
akash.arunabharathi.design3
Sequence (44 AA)
PLSHDGLCKKCTVYLKDGKYACNCVVGYIKKGTVCYRSGLFFWE