Peptide
EGFR
Yes
1_3_3_18_2900_4_1e20_ge20
Sequence (51 AA)
AGTPCPLDSNYCLNGGVCLYFSIVQEYACQCVVGFVGSRCEHKDVQWWDLR
Loading protein structure...
This protein was designed using ProtRL