Unknown
4
Sequence (85 AA)
MMDWERWVERMVTHFVGTNPEHEAERKIFREAYEEKVLPVLKRVYEKNPSSDGYIYFTREESREFQEKWMEVYDVVEELRKKKKE
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using EBindCraft
De novo RBX1 binders were generated with BindCraft using AlphaFold2-based hallucination and ProteinMPNN sequence redesign. The design strategy focused on the structured zinc-coordinated RING-domain region of RBX1 and deprioritized the disordered N-terminus. Candidate binders were filtered and ranked based on structural confidence, interface plausibility, redesign consistency, and developability-oriented selection criteria.
De novo RBX1 binders were generated with BindCraft using AlphaFold2-based hallucination and ProteinMPNN sequence redesign. The design strategy focused on the structured zinc-coordinated RING-domain region of RBX1 and deprioritized the disordered N-terminus. Candidate binders were filtered and ranked based on structural confidence, interface plausibility, redesign consistency, and developability-oriented selection criteria.