Peptide
EGFR
Yes
s1995825.timed_egf_netsolp_usability_consensus_2
Sequence (47 AA)
TCPEEYKGYCLHNAKCYRIEALNDVGCQCKKGFVGPRCSFKNLNENN
Loading protein structure...
This protein was designed using co-TIMED