Sequence (118 AA)
LVPRGSEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSDD
id: deep-zebra-lava

DER21
Weak
1.5e-6 M
True
22.2 kDa
183
id: crimson-lion-lotus

DER21
Weak
1.9e-6 M
True
13.6 kDa
112
id: hollow-zebra-snow

DER21
Weak
1.6e-6 M
True
17.3 kDa
143
id: swift-jaguar-granite

DER21
Weak
4.5e-6 M
True
10.0 kDa
81
id: silver-cat-lotus

DER21
None
--
True
20.9 kDa
174
id: small-falcon-quartz

DER21
None
--
True
20.8 kDa
174
id: ivory-deer-frost

DER21
None
--
True
15.4 kDa
129
id: bright-eagle-iron

DER21
None
--
True
20.8 kDa
174
id: strong-gecko-snow

DER21
None
--
True
20.5 kDa
167
id: radiant-swan-birch

DER21
None
--
True
20.5 kDa
167
id: soft-deer-granite

DER21
None
--
True
20.1 kDa
168
id: bright-shark-stone

DER21
None
--
True
21.7 kDa
177
id: hollow-fox-thorn

DER21
None
--
True
13.5 kDa
112
id: ivory-cobra-topaz

DER21
None
--
True
9.9 kDa
80
id: pale-toad-willow

DER21
None
--
True
17.2 kDa
139
id: azure-yak-bronze

DER21
None
--
True
17.2 kDa
139