Peptide
EGFR
Yes
qilin_y.test7
Sequence (38 AA)
VCMYIEALDKYACNCGGGGSGGGGSGGGGSYRDLKWWE
Loading protein structure...