Protein solid-owl-pine

Tanay Lohia / solid-owl-pine

Type

Unknown

Ref

MBL_012

Collections

T[GEM x Adaptyv: RBX1 Binder Design Competition] Submission 1

AGEM x Adaptyv RBX1 Binder Competition: Main Submissions

Sequence (130 AA)

SEELKKKAEEMLKRAEEAQEGSQEEQKRVAAEALEVAAEAEDEETREKAARAAAIAATAAGQTQTPEGINLVGAAHAALVAAGAGTEEGKEALKLAAEAARLALEGKTEEAAELVRKANLLAAKAALEKK

Computational Metrics

Experimental Metrics

Structure prediction unavailable

It might take a few hours to appear.

No experimental data

This protein hasn't been validated in the lab yet.

Design Method

This protein was designed using TLArena

Engine: Boltz-2 (structure prediction) + SolubleMPNN (sequence design), 5 cycles per full trajectory. Tournament per epitope combo: R1 — 100 seeds × 1 cycle, keep top 40% by ipTM (40 survive). R2 — 40 seeds × 2 cycles, keep top 20 based on trajectory improvement and high ipTM baseline. R3 — 20 seeds × 2 cycles, full 5-cycle refinement. 220 cycle-equivalents per combo × 4 epitope combos = 880 total designs. Epitope combos: C1 (GLMN-competitive), C2 (CRL state-selective), C3 (Extended E2 face), C4 (Full E2 sweep). Hotspot contacts: polar-only, all 12 Zn-coordinating residues excluded. No Cys in binder. Size range: 70–150 AA. Hardware: single A100 GPU.