Peptide
EGFR
Yes
antorsae.ta397unsafety_2
Sequence (34 AA)
CLHGTPVYISSLNKWSCVCDKGWYGERCEFRDLL
Loading protein structure...