Unknown
RBX1_l34_s19873_mpnn2
Sequence (34 AA)
SEEQREESRRFHEEQRRVRREFGREGFWEWMRSM
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using GAHotBind-RBX1
BindCraft run: Run 1 - Fixed protocol (6–24 aa, Peptide_Relaxed filter) Parameters: Length range: 6–24 aa | Protocol: Peptide_Relaxed | Prediction: HardTarget | AF2 interface protocol | Template: Masked | Filter: Peptide_Relaxed | Hotspots: A35, A36, A40, A46, A47, A72, A80, A87 | Pre-folded PDB complex Docking: HADDOCK 2.4 (web server, protein–peptide mode) + HADDOCK 3 (local CLI) Affinity: PRODIGY (interfacial contact regression model) Novelty: MMseqs2 + DIAMOND vs UniRef50 - no hit ≥75% identity