Unknown
Proteina_complexa_beam_rank_028
Sequence (120 AA)
SPKGVLFLGAVLEIEAAPGAEKYRALLEEVIQEAMEKTREELSADISGILPSLKPIIAETAKELKAEAAKLPNGIAVVPEKPIFVKNVESVEEGIKLVKDTFMKNLKELAAKKGLEVVEA
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using AGProteina-complexa
Proteina-Complexa was used in three modes: Best-of-N, beam search, and hydrogen bond-guided, of which beam search and hydrogen bond-guided were the most successful. AlphaFold and ESMFold were used as in-model reward signals, and the top designs were folded separately with Boltz-2. The best were then redesigned with ProteinMPNN and folded again.