Miniprotein
rbx1_v2_1390
VHTMESDLTDLRAEMWYLKVKALIFKLKMLVIRLEVHAARAKASTVEARLASLKQDVDDMRSKIQDFEAEIQDVKAEVHTIRTK
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using TTPhysics-regularized heptad scaffold generation
Pool size: 2,500 candidates. Length range: 60–91 aa with bias toward 70–84 aa. Charge fraction window: 25–45% DEKR. Max Cys: 1, max Pro: 1. Max hydrophobic run: 7 aa. Internal diversity filter: reject >80% identity to any accepted sequence. Ranking weights: first-pass foldability (0.40), physics regularization (0.30), ESM-2 PLL per-residue (0.30). ESM-2 model: esm2_t6_8M_UR50D. Target conformations: 1U6G(B), 2LGV(A), 3RTR(B), 4P5O(B). Submission: top 30 unique designs + 70 single-residue variants of apex scaffold at solvent-exposed positions. Seed: 42.