Peptide
EGFR
Yes
alex.naka.Ivysaur
Sequence (54 AA)
SLFSRCPKRYHGICNNNGQCRYAINLRTYTCICKSGYTGDRCQELDIRYLLLLN
Loading protein structure...