Peptide
EGFR
Yes
alecl.relaxedA
Sequence (50 AA)
SFSPFRPCSPEEESFCQHGECRFDVVEQRPACLCAGGYVGARCEAVDVAV
Loading protein structure...