Peptide
EGFR
Yes
keaun.GIFGVVFKADIARVSIDVAIDYSTGYLGSLTTFSGCNQ
Sequence (38 AA)
GIFGVVFKADIARVSIDVAIDYSTGYLGSLTTFSGCNQ
Loading protein structure...