Unknown
v3b_s16
Sequence (65 AA)
SEYDELLEEAKELAKEAGKLGKEAAELREEYPDDPEAQARAAKLRAEAEKLAKEALELFDEALSL
Structure prediction unavailable
It might take a few hours to appear.
No experimental data
This protein hasn't been validated in the lab yet.
This protein was designed using VLMosaic (Weights-optimized) — Protenix2025 + Boltz2
Protenix2025 hallucination, simplex-APGM optimizer. Phase 1: 120 steps (stepsize 0.15sqrt(65), momentum 0.3). Phase 2: 20 sharpening steps (stepsize 0.5sqrt(65), scale 1.3). 4 recycling steps, 20 feature sampling steps. Loss weights: 1.5x BinderTargetContact, 1.0x WithinBinderContact, 0.1x TargetBinderPAE, 0.1x BinderTargetPAE, 0.1x IPTMLoss, 0.4x WithinBinderPAE, 0.025x pTMEnergy, 0.1x PLDDTLoss, 8.0x MPNN SequenceRecovery (temp=0.01), 0.1x RadiusOfGyration, 0.5x BinderTargetIPSAE, 0.5x TargetBinderIPSAE, 1.5x IPSAE_min, 5.0x NoCysteine. Boltz2 validation: best-of-5, 8 recycling steps. Filters: ipTM >= 0.90, min_ipSAE >= 0.70, pLDDT >= 0.90, cysteine = 0. Compute: Modal A100-80GB.