Peptide
EGFR
Yes
alex.naka.Charmander
Sequence (54 AA)
NLFSRCPKRYHGICENNGQCRYAINLRTYTCICDSGYTGDRCQELDIRYLLLLN
Loading protein structure...