Peptide
EGFR
Yes
a.tucs.Andrejs_Tucs_seq4
Sequence (47 AA)
SCPSSLEGYCLNNGSCKYISDLNKYACNCVPGYTGERCEFLDFLIDE
Loading protein structure...